- SLC25A11 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82490
- Human
- SLC25A11
- OGC, PGL6, SLC20A4
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: AGLLRQATYT TTRLGIYTVL FERLTGADGT PPGFLLKAVI GMTAGATGAF VGTPAEVALI RMTADGRLPA DQRRGYK
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- solute carrier family 25 member 11
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK
Specifications/Features
Available conjugates: Unconjugated